Scaffold Ga0099823_1047087

Overview

Basic Information

• Taxon OID: 3300006944
• Scaffold ID: Ga0099823_1047087
• Source Dataset Name: Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2801
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (28.57%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location

• Location Name: California, USA
• Coordinates
  • Lat. (^o): 34.0722
  • Long. (^o): -118.4441
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042760	Metagenome	157	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0099823_10470877	F042760	N/A	MRKGAKMQDDIIEKVEIPKDSFDIINDSVLEEPQVPKIVQNEEI*IKYVMNHIIWKKNEVNIVKTFTYNIAMNVMKDN