NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0099823_1024704

Scaffold Ga0099823_1024704


Overview

Basic Information
Taxon OID3300006944 Open in IMG/M
Scaffold IDGa0099823_1024704 Open in IMG/M
Source Dataset NameRoot nodule microbial communities of legume samples collected from California, USA - Cow pea red BW
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5418
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (16.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location
Location NameCalifornia, USA
CoordinatesLat. (o)34.0722Long. (o)-118.4441Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F083792Metagenome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0099823_102470412F083792N/AMNFFYHHPIYIGVQKIQDLCQNFIIMFIICSLHHFDQVMYYYF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.