Scaffold Ga0081244_1537354

Overview

Basic Information

• Taxon OID: 3300006939
• Scaffold ID: Ga0081244_1537354
• Source Dataset Name: Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A10 (Metagenome Metatranscriptome) (version 2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 752
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil → Tropical Rainforest Soil Microbial Communities From The Amazon Forest, Brazil, For Analyzing Deforestation At Different Spatial Scales

Source Dataset Sampling Location

• Location Name: Amazon Forest, Brazil
• Coordinates
  • Lat. (^o): -10.0
  • Long. (^o): -62.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031003	Metagenome / Metatranscriptome	183	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081244_15373542	F031003	AGGGGG	MTYTHQDYVHSAPKRFSSRPGFASTAVYFESLAQKETRDEDRRQRLLEVAGFYHALAGIIPGIPERYKNNCGGLPLTRAERWHARAEECRTLADCFTSPTCRRQLTELAQSYDRMAVAAE