NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0098057_1018157

Scaffold Ga0098057_1018157


Overview

Basic Information
Taxon OID3300006926 Open in IMG/M
Scaffold IDGa0098057_1018157 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1778
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-16.21Long. (o)-76.61Alt. (m)Depth (m)250
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016597Metagenome / Metatranscriptome246N
F029557Metagenome / Metatranscriptome188N

Sequences

Protein IDFamilyRBSSequence
Ga0098057_10181571F029557GGAGMATPSNVHQKSIEFDEVNLFSIDKAVYDWFNTKHATNIKGRKVPVVFGGWERFAQMQDNKQDDNLNRMRDPSGMLILPLISLRRGDVTYNTERFIYQQADGSPRIEISRKVAMSNFDPNRRVPF
Ga0098057_10181572F016597GAGMAGNHGRFPFGSTTGDADYGLFFTPREMELFDNYNEELLGIVAQTGVTYWRIEPDSSDPNSIYGESEIKVTRDPVSLYCWVMLDEPETETNAFTVDVRRRIELYMHKDGLTERDIVPRMGDFVGYDNQYFEILRAGVPNFVYSYPQTKLGVIVRCLSVREGVFDPNRDFVNKEYVGDTETPY*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.