| Basic Information | |
|---|---|
| Taxon OID | 3300006923 Open in IMG/M |
| Scaffold ID | Ga0098053_1123517 Open in IMG/M |
| Source Dataset Name | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 519 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -14.51 | Long. (o) | -76.2 | Alt. (m) | Depth (m) | 100 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F079941 | Metagenome | 115 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0098053_11235171 | F079941 | N/A | APVNEVAPIPTPKDKLTNPSKKQTQSLETEKAKRAEEDIFDPTPGEPVTPESQVAMTPLTNQPMTSVFYSDIERALVNAPDEFPNKQAVLDFMNKNRIKKSEVEDYRIPSLLKLYDDGVPITKQDILSQIRTAPISGMKVHGTGKGSDIINPNGDVATRYTGYAESGSIDGT |
| ⦗Top⦘ |