Scaffold Ga0098053_1083457

Overview

Basic Information

• Taxon OID: 3300006923
• Scaffold ID: Ga0098053_1083457
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 647
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): -14.51
  • Long. (^o): -76.2
  • Depth (m): 100

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011944	Metagenome / Metatranscriptome	285	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0098053_10834572	F011944	AGTAGG	MASIVGKALRGFGRALKRGKNLRSSKTGTIKFKPGVGGLKESRKTFEGLQESTAEGVRKFGRPHTTKVLSEQKGKKSMPSIVRQSGDIERKRKKLGISKGKK*