Basic Information | |
---|---|
Taxon OID | 3300006921 Open in IMG/M |
Scaffold ID | Ga0098060_1152039 Open in IMG/M |
Source Dataset Name | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 641 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean | |||||||
Coordinates | Lat. (o) | -16.21 | Long. (o) | -76.63 | Alt. (m) | Depth (m) | 30 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F075987 | Metagenome | 118 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0098060_11520392 | F075987 | AGGAG | MIDTEYIDITSPEEGVISSKAVEHMVDNLALDELYSLRFTDVRFVLKDLLRDKYKRMAPTELHKLHKD |
⦗Top⦘ |