| Basic Information | |
|---|---|
| Taxon OID | 3300006918 Open in IMG/M |
| Scaffold ID | Ga0079216_10685791 Open in IMG/M |
| Source Dataset Name | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 726 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: North Logan, Utah | |||||||
| Coordinates | Lat. (o) | 41.7655 | Long. (o) | -111.8143 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033731 | Metagenome / Metatranscriptome | 176 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0079216_106857911 | F033731 | GGAGG | MSTVIHFECHNTTHLATRSRRGVGGTVMHHGTFGYCDGFASDNDHRWVATGGVYLEQLIREESDDRSDNTRYVPHALGSAGPLHLAR* |
| ⦗Top⦘ |