Scaffold Ga0079217_10292333

Overview

Basic Information

• Taxon OID: 3300006876
• Scaffold ID: Ga0079217_10292333
• Source Dataset Name: Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 897
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management

Source Dataset Sampling Location

• Location Name: USA: Utah
• Coordinates
  • Lat. (^o): 41.7655
  • Long. (^o): -111.8143

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010545	Metagenome / Metatranscriptome	302	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079217_102923331	F010545	AGTAG	MSFLDRFRRKTEDEASRIARLAKTGRMTDGNIIDAVSDRDGKIIQVTYTYMLAGVLYE