NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075473_10001028

Scaffold Ga0075473_10001028


Overview

Basic Information
Taxon OID3300006875 Open in IMG/M
Scaffold IDGa0075473_10001028 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11664
Total Scaffold Genes29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (10.34%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000716Metagenome / Metatranscriptome923Y
F022861Metagenome / Metatranscriptome212Y
F042298Metagenome / Metatranscriptome158Y
F064715Metagenome / Metatranscriptome128Y

Sequences

Protein IDFamilyRBSSequence
Ga0075473_1000102812F064715N/AMSKPNTKQIKSIADKSETVGNELYDEFQKGKKLETAKVAIAAFRNTLYANSLLIKNEKI*
Ga0075473_1000102816F000716N/AMKMYKMEKLKQEIRNYQLSAGKNYMQYESDGYSQYQNYLYKRALYGLNALTQEELASMCSKKKQRVINVYKRAQKVLNIFKQQVTNQYSNYIFQTLFPKSPWTDEMLEYTEVDEKFTNTLTFKDLNISKQDIIGIFITEGILPKNFLSLREAPVVLPRLKNEKL*
Ga0075473_100010286F042298N/AMGRMKEIYIQILNENGGIPEDMTIADVLKMRELNIYHWQEYERAQERARLQSNKQENLGETAKDSEGESIRRKENN*
Ga0075473_100010289F022861AGTAGMRAICIDSSNRPSKIPKNEWVVEGEVYTITRIVRMGLQDNKFGVLLKEVQLSSESFPYELYDAERFLPIDLLANALQETKETVKEADLELI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.