Scaffold Ga0101947_1064973

Overview

Basic Information

• Taxon OID: 3300006872
• Scaffold ID: Ga0101947_1064973
• Source Dataset Name: Biofilm microbial communities from drinking water pipes in Singapore
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: The Singapore Centre on Environmental Life Sciences Engineering
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1026
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Drinking Water Pipes → Biofilm Microbial Communities From Drinking Water Pipes In Singapore

Source Dataset Sampling Location

• Location Name: Singapore
• Coordinates
  • Lat. (^o): 1.3
  • Long. (^o): 103.8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102705	Metagenome / Metatranscriptome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101947_10649731	F102705	N/A	DCNHGSFGVFESNADPNTRNVPTFDGKGQHFILTSACRYDDSLFYRKFGSDGKYSGDTNFLWDFWFYIPTTTKVNTVQALEFDLFQAVPLHDGVHEFMFGSQCNFVTNQWQLWLPRGGGLAWVDAGISPCRFKTGEWHHATYFLQRVTPSAYQEIPDTFGPTTDKNTSLRYGTLTIDGETVYLGGVAWSTIPNPAWAAVLGVQHQLDSAVSGVVIEQYTDRESLTSW*