NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0101947_1047593

Scaffold Ga0101947_1047593


Overview

Basic Information
Taxon OID3300006872 Open in IMG/M
Scaffold IDGa0101947_1047593 Open in IMG/M
Source Dataset NameBiofilm microbial communities from drinking water pipes in Singapore
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterThe Singapore Centre on Environmental Life Sciences Engineering
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1461
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Drinking Water Pipes → Biofilm Microbial Communities From Drinking Water Pipes In Singapore

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.3Long. (o)103.8Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000372Metagenome / Metatranscriptome1220Y

Sequences

Protein IDFamilyRBSSequence
Ga0101947_10475932F000372N/AMRGAYRLTPSGSAIARRWSVIASGLLILALALVVIYTGPDAFRSPLALVVVAAIGLSALLLQLRFRRDLPQVKSTFWLNLLGLVCAAAALIADFLNVSRPALAAVAFASVICFAISGSLILHSLRRPRKASQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.