| Basic Information | |
|---|---|
| Taxon OID | 3300006871 Open in IMG/M |
| Scaffold ID | Ga0075434_102440805 Open in IMG/M |
| Source Dataset Name | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 524 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Tennessee | |||||||
| Coordinates | Lat. (o) | 35.8444 | Long. (o) | -83.9599 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015074 | Metagenome / Metatranscriptome | 257 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0075434_1024408051 | F015074 | N/A | RELNAAIVSADISASYEEFIAIVDQFYAEDVEVRSDSSPEPLIGRDLLKSRLLGFLVPLHVMAEIGGLSVSVSERPIAGDSLDEQHSQWSLELVGVAGRAVRVSWSVRRRWKQSRVVGEYHYDHEQDGEALGLSDLRIPTFNGIEEID* |
| ⦗Top⦘ |