Scaffold Ga0079046_1005742

Overview

Basic Information

• Taxon OID: 3300006859
• Scaffold ID: Ga0079046_1005742
• Source Dataset Name: Hot spring microbial mat communities from Yellowstone National Park, Wyoming, USA - BED_host_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2365
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → Thermoplasmataceae → Thermoplasma → Thermoplasma volcanium → Thermoplasma volcanium GSS1 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location

• Location Name: USA: Yellowstone National Park
• Coordinates
  • Lat. (^o): 44.7315
  • Long. (^o): -110.7113

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050482	Metagenome / Metatranscriptome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079046_10057421	F050482	N/A	MESDKMNHETMEQELKKMGFNIIDVKNRFPSHTYHIYAVLKNGYALSICQGIGVHSSIGKDPYTQSETFEVALGRYVGGVFYLIYEGKWKDDVLGWQSPEDVIELAKSVKRLRL*