Scaffold Ga0098066_1024141

Overview

Basic Information

• Taxon OID: 3300006856
• Scaffold ID: Ga0098066_1024141
• Source Dataset Name: Marine viral communities from Cariaco Basin, Caribbean Sea - 25B_WHOI_OMZ_CsCl
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 945
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Caribbean Sea: Cariaco Basin
• Coordinates
  • Lat. (^o): 10.847
  • Long. (^o): -65.114
  • Depth (m): 247

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050757	Metagenome / Metatranscriptome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0098066_10241412	F050757	N/A	MSRKKDGTTEYSWSELAYRIDPELSAPEKVYVFDNGNRVFYQPRKRVNVNHARNRKKS*