NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075421_101801454

Scaffold Ga0075421_101801454


Overview

Basic Information
Taxon OID3300006845 Open in IMG/M
Scaffold IDGa0075421_101801454 Open in IMG/M
Source Dataset NamePopulus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)658
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location
Location NameUSA: Tennessee
CoordinatesLat. (o)35.8443Long. (o)-83.9607Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F081518Metagenome114N

Sequences

Protein IDFamilyRBSSequence
Ga0075421_1018014541F081518N/ASPVLVRRAHIRIVGGSVMLSSRRTWGFAFVASIGAVFGVSVAAEAPPDTPPDTQPPDTQIVAIWQIERIDFVYSSTTVRYSCGNLQRRIAEILQAVGANARMGVELGCNSGELVRYANVHLTLAVPVEATEENVRAATDFDTHDELVARLHQTQLPSASDIVRFPASWRTVALTRSPPLSLGPGDCDLLRAMRDDVFPLLRVRVVSSGLRCGSGADTRI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.