NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0101790_120399

Scaffold Ga0101790_120399


Overview

Basic Information
Taxon OID3300006840 Open in IMG/M
Scaffold IDGa0101790_120399 Open in IMG/M
Source Dataset NameAnaerobic bioreactor microbial communities from Canach, Luxembourg
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCentre de Recherche Public Gabriel Lippmann
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1333
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Anaerobic Reactor → Anaerobic Bioreactor Microbial Communities From Different Locations In Luxembourg

Source Dataset Sampling Location
Location NameCanach, Luxembourg
CoordinatesLat. (o)49.609581Long. (o)6.325797Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029085Metagenome / Metatranscriptome189N
F047639Metagenome / Metatranscriptome149Y
F075995Metagenome / Metatranscriptome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0101790_1203992F075995AGGGGGMKNKLFGVYKPLGKANVFITKNFKRVFYGPRTLYAKDLTGRVYVRYKNKYYQAHYDGRHTYNVRIR*
Ga0101790_1203993F029085GGAMKNIKEEKLKIDELLEENISEQLESGSPDLVSLIAISELTNLDKLKVITRLKDEQVPLLSKLYMYAETFNIPFIKNLADNILQLQISIRGLGRKELVNIVRESTPQEVKRSLFGPKDVFR
Ga0101790_1203994F047639AGGAGMRLFNKHKYLRVIKFNSDKSTTVTYHLSDKFKPSFLINPDHIFNYKGYRTIVITDKSAETINPLDFESKFNHEDFQTAIESKLIKDTFTTLKPNKLDRTTFMLLLILILNIAVIYLLLKWQGMI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.