| Basic Information | |
|---|---|
| Taxon OID | 3300006840 Open in IMG/M |
| Scaffold ID | Ga0101790_108036 Open in IMG/M |
| Source Dataset Name | Anaerobic bioreactor microbial communities from Canach, Luxembourg |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Centre de Recherche Public Gabriel Lippmann |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2633 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Anaerobic Reactor → Anaerobic Bioreactor Microbial Communities From Different Locations In Luxembourg |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canach, Luxembourg | |||||||
| Coordinates | Lat. (o) | 49.609581 | Long. (o) | 6.325797 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001938 | Metagenome / Metatranscriptome | 614 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0101790_1080361 | F001938 | N/A | IEKIYKNKYMATCDNCGEGQECDSWTDVLDFMNTEGWKKKLVDGEWKHYCPECYET* |
| ⦗Top⦘ |