Scaffold Ga0101790_100711

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0101790_100711

Scaffold Ga0101790_100711

Overview

Basic Information
Taxon OID	3300006840 Open in IMG/M
Scaffold ID	Ga0101790_100711 Open in IMG/M
Source Dataset Name	Anaerobic bioreactor microbial communities from Canach, Luxembourg
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Centre de Recherche Public Gabriel Lippmann
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4379
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (77.78%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Anaerobic Reactor → Anaerobic Bioreactor Microbial Communities From Different Locations In Luxembourg

Source Dataset Sampling Location
Location Name	Canach, Luxembourg
Coordinates	Lat. (^o)	49.609581	Long. (^o)	6.325797	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101009	Metagenome / Metatranscriptome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101790_1007119	F101009	GGAGG	MELLKCGQCGDRPGLLMAVTDRVAGTNINLCYECYKNYVRHVKDGKADRVAVVYD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.