Scaffold Ga0070749_10467834

Overview

Basic Information

• Taxon OID: 3300006802
• Scaffold ID: Ga0070749_10467834
• Source Dataset Name: Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 689
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location

• Location Name: USA: Delaware Bay
• Coordinates
  • Lat. (^o): 39.12
  • Long. (^o): -75.25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072111	Metagenome	121	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0070749_104678343	F072111	N/A	GGRMKSQAVLAIAIFAHLGLFLFVDSSFEGSSRWKMWALYGSSLLSVAVWAAYVVKDDLDGGGAA*