Basic Information | |
---|---|
Taxon OID | 3300006801 Open in IMG/M |
Scaffold ID | Ga0079223_10142215 Open in IMG/M |
Source Dataset Name | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2011 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1505 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Utah | |||||||
Coordinates | Lat. (o) | 41.7655 | Long. (o) | -111.8143 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F090570 | Metagenome / Metatranscriptome | 108 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0079223_101422153 | F090570 | AGG | MDEFGNAYIEKVWCNSVRTPKPLKIIPYKKDFKVFFSVKGTEIGRITIGIFVDDILDQMLTTNILEKNKSLAIWFWYPYKHKQIGKHVIQFKIGEATDRTADSVTWKYTSDKYIVEVK* |
⦗Top⦘ |