NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0098055_1008350

Scaffold Ga0098055_1008350


Overview

Basic Information
Taxon OID3300006793 Open in IMG/M
Scaffold IDGa0098055_1008350 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4779
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-14.51Long. (o)-76.2Alt. (m)Depth (m)15
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002716Metagenome / Metatranscriptome535Y
F005495Metagenome / Metatranscriptome399Y
F015474Metagenome / Metatranscriptome254Y

Sequences

Protein IDFamilyRBSSequence
Ga0098055_10083501F015474GGAMSGQFPTNPNFRSLNFKDNRPTLVNQTLSGKKQVRQIGAQYFSFTVAMPPLQQEKSQEIFAFLQKQKGSFEDFTIVAPLDNLGAGK
Ga0098055_10083507F002716GAGGMSQFRLETEEDMLGYLDINFGHGVSAVYINNGTSSTINIILNNEYIEQQEGIGVEALKPIAYCRTIDVPNVAFGNSLNVSAIKDTNGNILKAAQNYTVVNIQADRTGFSALMLEEV*
Ga0098055_10083509F005495N/AMLKWNGGSNTPNLNMKKYKILTDTMAGGSKVHAGDIVELTENEGHSLCGYGKAEVHVGKPKAEKQDRSVGLKTSKVKAPKTRAKK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.