Scaffold Ga0098074_1082089

Overview

Basic Information

• Taxon OID: 3300006790
• Scaffold ID: Ga0098074_1082089
• Source Dataset Name: Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 868
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Atlantic Ocean: Gulf of Mexico
• Coordinates
  • Lat. (^o): 28.867
  • Long. (^o): -90.467
  • Depth (m): 18

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022083	Metagenome / Metatranscriptome	216	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0098074_10820892	F022083	AGGA	MAKPIGQDSSLNISLPMLLQAVGFIASLVWMYGQLNTRISFLEHQANTNERSIEEMKAMQDLPIPSDVRQDEKIKRLEDEIMRLRDGKGH*