Scaffold Ga0098054_1017841

Overview

Basic Information

• Taxon OID: 3300006789
• Scaffold ID: Ga0098054_1017841
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2847
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): -14.51
  • Long. (^o): -76.2
  • Depth (m): 45

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003898	Metagenome / Metatranscriptome	463	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0098054_10178413	F003898	AGCAGG	MGNIIDMDSLKVSGISTSLGLVYWLDVLSVLLMCVMFSVNIYYLWLKAKKVKE*