Scaffold Ga0098071_119519

Overview

Basic Information

• Taxon OID: 3300006768
• Scaffold ID: Ga0098071_119519
• Source Dataset Name: Marine viral communities from Cariaco Basin, Caribbean Sea - 29_WHOI_OMZ
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 579
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Caribbean Sea: Cariaco Basin
• Coordinates
  • Lat. (^o): 10.847
  • Long. (^o): -65.114
  • Depth (m): 143

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046314	Metagenome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0098071_1195193	F046314	N/A	MALETRKEKMDHMFALIEESRVLVDRRGEHNDIEPAIRQLNYRVDELKKELSLNKYELEKEKGIDSMFNMNRGNPYNEGSGGDDD*