NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079222_12439579

Scaffold Ga0079222_12439579


Overview

Basic Information
Taxon OID3300006755 Open in IMG/M
Scaffold IDGa0079222_12439579 Open in IMG/M
Source Dataset NameAgricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)524
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium L13(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.8834Long. (o)-83.4195Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005782Metagenome390Y

Sequences

Protein IDFamilyRBSSequence
Ga0079222_124395791F005782N/ADRRLELARRRLATFAAPGGPWEVKDVSQTGFRLIAPMSVANAVTLNTLAAIRPHGQASWTLGIVRRMKRLTADRAEIGLQIIANTLVGVDLMEQRKNVDDDYSVDGEAITMNGRSFGALFLALRKRDGDAPVQSLIVPGVEYQASKRFRLLTSKSSSPIRFGRLIEQQPDWVWT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.