Scaffold Ga0098039_1203697

Overview

Basic Information

• Taxon OID: 3300006753
• Scaffold ID: Ga0098039_1203697
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 670
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): -11.499
  • Long. (^o): -81.405
  • Depth (m): 210

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022530	Metagenome	214	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0098039_12036972	F022530	GGGGG	MFKKLKKAGAVYIAFGIGTIFGSIIASIMGTLIYQVVTGNKDAAKILQITECLEERAEK*