Scaffold Ga0098048_1189549

Overview

Basic Information

• Taxon OID: 3300006752
• Scaffold ID: Ga0098048_1189549
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 608
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → unclassified Flammeovirgaceae → Flammeovirgaceae bacterium TMED32 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): -14.509
  • Long. (^o): -76.198
  • Depth (m): 48

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055643	Metagenome / Metatranscriptome	138	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0098048_11895492	F055643	N/A	MTIEELISIINATEDGEIWLYSNKLRDHLSTVEQALEEDRIYFVKTEVGNSVTEFIRVSP