Scaffold Ga0098042_1000455

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0098042_1000455

Scaffold Ga0098042_1000455

Overview

Basic Information
Taxon OID	3300006749 Open in IMG/M
Scaffold ID	Ga0098042_1000455 Open in IMG/M
Source Dataset Name	Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	15829
Total Scaffold Genes	34 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	31 (91.18%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)	-14.198	Long. (^o)	-77.499	Alt. (m)		Depth (m)	38
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051968	Metagenome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0098042_100045523	F051968	GAGG	MNIEKVTNMMCDFVAYVDDFYNEKSGIYPIKGMTDMMVIKAVQKHVANVGMDFCADSVDREKVRDIILADNDVIWSAN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.