Scaffold Ga0098073_1018213

Overview

Basic Information

• Taxon OID: 3300006734
• Scaffold ID: Ga0098073_1018213
• Source Dataset Name: Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1076
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Gulf of Mexico
• Coordinates
  • Lat. (^o): 28.867
  • Long. (^o): -90.467
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018836	Metagenome / Metatranscriptome	233	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0098073_10182131	F018836	AGGAG	MSSSVPIDQSNVDDWFDLDKYKQAAEVAYSFSKKKLEDTGTQERETIGKGAEEQRTSAEQAQRFKQEDEARDYGQAQRAYRY*