Basic Information | |
---|---|
Taxon OID | 3300006734 Open in IMG/M |
Scaffold ID | Ga0098073_1005659 Open in IMG/M |
Source Dataset Name | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2510 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Prochlorotrichaceae → Nodosilinea → Nodosilinea nodulosa | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gulf of Mexico | |||||||
Coordinates | Lat. (o) | 28.867 | Long. (o) | -90.467 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F018919 | Metagenome / Metatranscriptome | 232 | Y |
F077239 | Metagenome | 117 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0098073_10056592 | F018919 | AGGAGG | MAINPNQIAVTKIYPGNYTNVLKYWHETKSVDFLNENGTAETLTNQPVGGPVGVVFRPGWIAQQAVGYVDLSYQALGSVNQLEYYTQPYASGDSSNKPFTNGSVIIPSPDYHKDVRADITTGITVPSGAFVYRVGLRVDGGDVVSSGVTGGSATPRLGLGPGLGIGLTTTPSPSGFYATIVGSNSRIENGSYNSSNAINGANAHQVTVATEYALATVGNLGGSAASGLAQASGVYDPRAGVGKLSGKNKALAICEVCWIVPDEPPKRDDVVLQPAGLVESSVYTTTTPA* |
Ga0098073_10056595 | F077239 | AGGAG | VAELSVQQLEQIYSYLAQQGVVTQPTTTDRTKREIVYAALNQIGRNPGQVF |
⦗Top⦘ |