Scaffold Ga0031676_1408835

Overview

Basic Information

• Taxon OID: 3300006728
• Scaffold ID: Ga0031676_1408835
• Source Dataset Name: Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2967 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 567
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin1 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: South of Funchal, North Atlantic Ocean
• Coordinates
  • Lat. (^o): 32.08
  • Long. (^o): -17.27

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076161	Metagenome / Metatranscriptome	118	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0031676_14088351	F076161	N/A	RFMKSINFSSRCPKTGFRAFAEKPVAKSLLLLQFGGQKMPPQRASIPNRLTAWTVPQIAADPKERSNLLSSPTNPDAATGKPV*