Scaffold Ga0031676_1355529

Overview

Basic Information

• Taxon OID: 3300006728
• Scaffold ID: Ga0031676_1355529
• Source Dataset Name: Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2967 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 619
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: South of Funchal, North Atlantic Ocean
• Coordinates
  • Lat. (^o): 32.08
  • Long. (^o): -17.27

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058927	Metagenome / Metatranscriptome	134	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0031676_13555291	F058927	N/A	HQFLETLPDERAATVSDADIAAHENARQEAAKIKPNPERDFFQYVHKTLDQINKDMSFGVSFSQTKRNDHARSLCTELGGELKYYAKTVVDTVNGGPNETITEANAHNMAQALFFDVQLQDYMKGLGMAPDEELNLNMNRLKALQKLYLFEQKGGENYLG*