NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0031676_1251924

Scaffold Ga0031676_1251924


Overview

Basic Information
Taxon OID3300006728 Open in IMG/M
Scaffold IDGa0031676_1251924 Open in IMG/M
Source Dataset NameMetatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2967 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)523
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameSouth of Funchal, North Atlantic Ocean
CoordinatesLat. (o)32.08Long. (o)-17.27Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056538Metatranscriptome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0031676_12519241F056538N/AVQKVIEMMNGMLEKGKKEKHDEQVQFAAYKQFCDDTSAEKGANIADAEEQIEVLKADIEQYATDATMLGKKIKALEDDVACWEGDVNAATKVREIEKSDYDTTHTDYSESIDALERAIAVLKKGTGDRAQAALTQVKQQSRIPDKARATIEAFLAEDDSDVGLGVSAPEANGYE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.