Basic Information | |
---|---|
Taxon OID | 3300006715 Open in IMG/M |
Scaffold ID | Ga0031670_1155814 Open in IMG/M |
Source Dataset Name | Metatranscriptome of deep ocean microbial communities from Pacific Ocean - MP1481 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 528 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South of Fiji, South Pacific Ocean | |||||||
Coordinates | Lat. (o) | -28.41 | Long. (o) | 179.14 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F047906 | Metagenome / Metatranscriptome | 149 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0031670_11558142 | F047906 | AGGGGG | VALAAKFTQKRTVTKERTPDAIRVPVAHRPVVGLGVLAVRWHHAVTKVRVALRLDMLAVAKRVSRVEIKFAVTAKAGLVQTQRLAVANAVANAVVIRIVVAERVA* |
⦗Top⦘ |