Scaffold Ga0031673_1196993

Overview

Basic Information

• Taxon OID: 3300006711
• Scaffold ID: Ga0031673_1196993
• Source Dataset Name: Metatranscriptome of deep ocean microbial communities from Pacific Ocean - MP2255 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 895
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Acartiidae → Acartia → Acartia pacifica (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: West of El Salvador, Pacific Ocean
• Coordinates
  • Lat. (^o): 10.09
  • Long. (^o): -99.25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009881	Metatranscriptome	311	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0031673_11969931	F009881	GGAGG	MLILIHILFSLQLVGESELGGLLLQFGKLVLVLGNLLKGWLDELALHVTDRDGELVDLEITEDDLTLEEEHLSLQLVPLVEVSLADLLEIIHGGIVNVSLSSASLGNDTESLLGLALLLLLELLSGLLAKKSSELLLTLWGHKSLLLGHDEFCY*