| Basic Information | |
|---|---|
| Taxon OID | 3300006709 Open in IMG/M |
| Scaffold ID | Ga0031685_1228680 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP727 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 711 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Tenebrionoidea → Tenebrionidae → Tenebrionidae incertae sedis → Tribolium → Tribolium castaneum | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | -31.83 | Long. (o) | 6.86 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000049 | Metagenome / Metatranscriptome | 3277 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0031685_12286801 | F000049 | N/A | MENVEKAIARIMADKVYTSAEFKRERDNFHALCKDLERAEVKKWLHQILEILMAERAKSQQETENEKLNVLIKKHEELIPSVQKTSVMVDLYWKCYAYGDELKPHIEFLDGIMLSSTRDIAPSCVENVDELIERQEKSLVQLDSKRNVVNDLIEKGKKILEHPDKPKFLEGNVKRIQEGWDDTKKKAQDRLKLLQDTKEAWVGYAENNETIAAQFEVAEAEIKLVKKRYNLEDALSD |
| ⦗Top⦘ |