Scaffold Ga0101770_1136136

Overview

Basic Information

• Taxon OID: 3300006674
• Scaffold ID: Ga0101770_1136136
• Source Dataset Name: Anaerobic microbial community collected from a biogas reactor in Fredrikstad, Norway. Combined Assembly of Gp0117115, Gp0124038
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Norwegian Sequencing Centre (NSC)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1084
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae → unclassified Thermoanaerobacteraceae → Thermoanaerobacteraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Food Waste → Mirobial Communities In Biogas Reactors

Source Dataset Sampling Location

• Location Name: Fredrikstad, Norway
• Coordinates
  • Lat. (^o): 59.185359
  • Long. (^o): 10.970104

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001938	Metagenome / Metatranscriptome	614	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101770_11361362	F001938	AGGAG	MIEKIYKNKYMAICDNCGIGQECDSWADAIDFMNEEGWKKKLVDGEWKHFCPECQESEGEEG*