Scaffold Ga0101770_1128528

Overview

Basic Information

• Taxon OID: 3300006674
• Scaffold ID: Ga0101770_1128528
• Source Dataset Name: Anaerobic microbial community collected from a biogas reactor in Fredrikstad, Norway. Combined Assembly of Gp0117115, Gp0124038
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Norwegian Sequencing Centre (NSC)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1773
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Food Waste → Mirobial Communities In Biogas Reactors

Source Dataset Sampling Location

• Location Name: Fredrikstad, Norway
• Coordinates
  • Lat. (^o): 59.185359
  • Long. (^o): 10.970104

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088753	Metagenome / Metatranscriptome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0101770_11285283	F088753	GGTGG	MTECGRILQELEMLKKTNDERLARRLSDWYGFVLSELTASRVGDXIRSVPVDFVSLPFNGKRVENLXNKCIKTLFEMAEDGRIPFETTAYMAESLRTGRKVRLRHAGQLCSKKLGPVLPIILHKETITEMILREAKLLALSKVAVVVKLYCRIPGEFYPAVCCLSSDCDIAKRALRNITKDFVRDRMASFPRVDLKKDFFYLESGYGFDENGIIFINKGRVYYRTNDGTHELPDADLDSREELFMQIARAVAKG