Scaffold Ga0101770_1116771

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0101770_1116771

Scaffold Ga0101770_1116771

Overview

Basic Information
Taxon OID	3300006674 Open in IMG/M
Scaffold ID	Ga0101770_1116771 Open in IMG/M
Source Dataset Name	Anaerobic microbial community collected from a biogas reactor in Fredrikstad, Norway. Combined Assembly of Gp0117115, Gp0124038
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Norwegian Sequencing Centre (NSC)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1701
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Food Waste → Mirobial Communities In Biogas Reactors

Source Dataset Sampling Location
Location Name	Fredrikstad, Norway
Coordinates	Lat. (^o)	59.185359	Long. (^o)	10.970104	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103108	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0101770_11167714	F103108	N/A	GEKFFRCLRMPGYFPPKGNLESFAERLCGLLLEKHEEALLYTEGGLRRVLEGFPAAEEILEKLSSSWEEDAPDAYAVVSRSDDEWAVLFGYEDGVEAVLCKKGRTVRIGADEPER*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.