| Basic Information | |
|---|---|
| Taxon OID | 3300006674 Open in IMG/M |
| Scaffold ID | Ga0101770_1108463 Open in IMG/M |
| Source Dataset Name | Anaerobic microbial community collected from a biogas reactor in Fredrikstad, Norway. Combined Assembly of Gp0117115, Gp0124038 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Norwegian Sequencing Centre (NSC) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3113 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Food Waste → Mirobial Communities In Biogas Reactors |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Fredrikstad, Norway | |||||||
| Coordinates | Lat. (o) | 59.185359 | Long. (o) | 10.970104 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047640 | Metagenome / Metatranscriptome | 149 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0101770_11084632 | F047640 | N/A | MLNXEIDFESNLKEKQEKTLKQELSAYLQALKNVHSNKPAETPKIGSFPLILDKYAIERVILLYRLLQHGVLPAYQLILDILRVYTLDATTISDDTKREILAMIHNYD* |
| ⦗Top⦘ |