Scaffold Ga0101770_1070491

Overview

Basic Information

• Taxon OID: 3300006674
• Scaffold ID: Ga0101770_1070491
• Source Dataset Name: Anaerobic microbial community collected from a biogas reactor in Fredrikstad, Norway. Combined Assembly of Gp0117115, Gp0124038
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Norwegian Sequencing Centre (NSC)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3570
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Food Waste → Mirobial Communities In Biogas Reactors

Source Dataset Sampling Location

• Location Name: Fredrikstad, Norway
• Coordinates
  • Lat. (^o): 59.185359
  • Long. (^o): 10.970104

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001938	Metagenome / Metatranscriptome	614	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101770_10704911	F001938	N/A	VGKNWVRRIEVIEKIYKNKYMATCDNCGEGQEFDTWTDALEYMFEEGWKKKLVDGEWKHYCPECQEG*