| Basic Information | |
|---|---|
| Taxon OID | 3300006674 Open in IMG/M |
| Scaffold ID | Ga0101770_1038227 Open in IMG/M |
| Source Dataset Name | Anaerobic microbial community collected from a biogas reactor in Fredrikstad, Norway. Combined Assembly of Gp0117115, Gp0124038 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Norwegian Sequencing Centre (NSC) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4197 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin035 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Food Waste → Mirobial Communities In Biogas Reactors |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Fredrikstad, Norway | |||||||
| Coordinates | Lat. (o) | 59.185359 | Long. (o) | 10.970104 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013091 | Metagenome / Metatranscriptome | 274 | Y |
| F033394 | Metagenome / Metatranscriptome | 177 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0101770_10382272 | F033394 | AGG | MKSIYIYFNNEIADIYYKDNSKNLHCTINLYTTNKEIREQFRKNLLERYWDKIKITDINYLKMIVKDSFVQIFTLQREKIDKND* |
| Ga0101770_10382275 | F013091 | AGGAGG | MICKLTNGISLKDCDTPGGVSESYFINIEDVDTLTVTDFQVSALTLKTDAKAYKIAFEPETSNFSSNAVGSQENSSAAFEQACEIKINKVDNNVLKQIDALTKGRHLVIIQKNDKTYEMYFHEGGAKFVANYSTGTALEDASGVTLTATHRQTSNMLLVSATVMSSLTIAEETP* |
| ⦗Top⦘ |