Scaffold Ga0101770_1030401

Overview

Basic Information

• Taxon OID: 3300006674
• Scaffold ID: Ga0101770_1030401
• Source Dataset Name: Anaerobic microbial community collected from a biogas reactor in Fredrikstad, Norway. Combined Assembly of Gp0117115, Gp0124038
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Norwegian Sequencing Centre (NSC)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7929
• Total Scaffold Genes: 13
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (61.54%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Coprothermobacterota → Coprothermobacteria → Coprothermobacterales → Coprothermobacteraceae → Coprothermobacter (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Food Waste → Mirobial Communities In Biogas Reactors

Source Dataset Sampling Location

• Location Name: Fredrikstad, Norway
• Coordinates
  • Lat. (^o): 59.185359
  • Long. (^o): 10.970104

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097174	Metagenome / Metatranscriptome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0101770_10304017	F097174	AGGAG	MHLLQHGTKNKKGYITANAVLLALFVMLIVQIAMQNITAVTLQSRLFQATEQDRLDVKSGVYRELSKVVANPAYTSAPYTLTLGNNAEVTVSTVNVGTSTVEKKITSQKGTLQLVVNVFKTPDNRWIIYRWAWVP*