Scaffold Ga0101728_108199

Overview

Basic Information

• Taxon OID: 3300006654
• Scaffold ID: Ga0101728_108199
• Source Dataset Name: Combined Assembly of Gp0125100, Gp0113270, Gp0125099
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: The Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 15488
• Total Scaffold Genes: 21
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 17 (80.95%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Abyssal Plane → Marine → Deep Marine Subsurface Microbial Communities From Mid-Atlantic Ridge (Iodp Expedition 336)

Source Dataset Sampling Location

• Location Name: North Pond, Atlantic Ocean
• Coordinates
  • Lat. (^o): 22.78
  • Long. (^o): -46.09
  • Depth (m): 4350

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041250	Metagenome / Metatranscriptome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101728_1081991	F041250	GAG	MAISDQMSAVAEHSIVKIATPFLVAGIIALTTWLFSSVMSLEQQVKLLSDGKILHLSEKLSGLSNRIDSMNITLTDLRVSLGGRDRRDRQD*