| Basic Information | |
|---|---|
| Taxon OID | 3300006639 Open in IMG/M |
| Scaffold ID | Ga0079301_1106579 Open in IMG/M |
| Source Dataset Name | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 854 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Ohio | |||||||
| Coordinates | Lat. (o) | 40.178 | Long. (o) | -81.073 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F022872 | Metagenome | 212 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0079301_11065791 | F022872 | N/A | MSWQIPTQIEQDIIAGKAQYRTFQTGVGGQSILPVPSNAYAVIFGYDFSPAGGGIQEFQQVGSNPGLSPDIMRWFETQQISFYTGTDFYPFIHHVNLERTGVQTTDNLSFGYFTIDNSPIARQVYITSDKDITISVGLILDSDVASLNAIPQTNRTPALLTYGGSAQAVATQTDFGPAATPIQFMQPSPKDYQDFAFGLLPNGATGQAFATPDTARGLYDPSAYLTTLGATFRDAAAANYFLCLHYALYTQSVPESRG* |
| ⦗Top⦘ |