| Basic Information | |
|---|---|
| Taxon OID | 3300006620 Open in IMG/M |
| Scaffold ID | Ga0101444_106337 Open in IMG/M |
| Source Dataset Name | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ10 time point |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Australian Centre for Ecogenomics |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2552 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water → Exploring Phylogenetic Diversity In Port Hacking Ocean In Sydney, Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Port Hacking, Australia | |||||||
| Coordinates | Lat. (o) | -34.1192 | Long. (o) | 151.2267 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024299 | Metagenome / Metatranscriptome | 206 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0101444_1063373 | F024299 | AGGAG | MQQANNTKIKAVTTVEGEACATLHINLAAHNLQVNGRAVNSITMYADAECCGDLAVNWEEEDDSNYKHNTALLMRDIHDSNNNTETMGAFYWDGEFTSTLHTLLLENGFSSAAVEXXXXXXXXXXXRTCEL* |
| ⦗Top⦘ |