| Basic Information | |
|---|---|
| Taxon OID | 3300006581 Open in IMG/M |
| Scaffold ID | Ga0074048_12600174 Open in IMG/M |
| Source Dataset Name | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 729 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Rhizosphere Microbial Communities From Centre Inrs-Institut Armand-Frappier, Laval, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Laval, Canada | |||||||
| Coordinates | Lat. (o) | 45.54 | Long. (o) | -73.72 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052843 | Metagenome / Metatranscriptome | 142 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074048_126001742 | F052843 | N/A | VAALLAEANSIKQDYADIITADYPNLKTLESICQLSPERLVEHAKALQTFRDRWALLRKEYAARLDCTNTVEDSLRNLSLADMSYGADLVKSMVESLRNELTQVSLAQKDVLNLDDKMNAAQKAIENIQQIRGGVCR* |
| ⦗Top⦘ |