| Basic Information | |
|---|---|
| Taxon OID | 3300006573 Open in IMG/M |
| Scaffold ID | Ga0074055_11029191 Open in IMG/M |
| Source Dataset Name | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1372 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Rhizosphere Microbial Communities From Centre Inrs-Institut Armand-Frappier, Laval, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Laval, Canada | |||||||
| Coordinates | Lat. (o) | 45.54 | Long. (o) | -73.72 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032481 | Metagenome / Metatranscriptome | 180 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074055_110291912 | F032481 | GGA | MRASLASLASCLLVGCAATKIENTWTATQPPAQPIQKFAVFAVTGSPSGRIAYEETLTTRLKDAGLPAVPGYDLVTYDEHPSKEEVMRRLEDKQIDGALVSRVDRRTTTTQSTPVWVGGGYAVGFYDYYYTPVAMGTYTTESNEFVVETVLYDLRDNRPYWMARSNTSRTAPTKFANDIAKPVADSLKASGLFGPASR* |
| ⦗Top⦘ |