Scaffold Ga0099958_1021498

Overview

Basic Information

• Taxon OID: 3300006567
• Scaffold ID: Ga0099958_1021498
• Source Dataset Name: Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0770m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Hawaii
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 598
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED277 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 22.75
  • Long. (^o): -158.0
  • Depth (m): 770

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048568	Metagenome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0099958_10214983	F048568	N/A	YPYFRQRVVEIGKYKENVSEDASFCLDVAEQLDVRPKILPQLRINHLKELYI*LYLCMRRFKWLLE*